PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00702g11003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family HD-ZIP
Protein Properties Length: 306aa    MW: 34343.6 Da    PI: 7.7859
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00702g11003.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.26.6e-19146200256
                               T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                  Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                               rk+ +++k+q  +Lee F+++++++ +++  LAk+lgL  rqV vWFqNrRa+ k
  Peinf101Scf00702g11003.1 146 RKKLRLSKDQSAVLEESFKEHHTLNPKQKLALAKRLGLRPRQVEVWFQNRRARTK 200
                               788899***********************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046181.4E-312113IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.601.2E-18128196IPR009057Homeodomain-like
SuperFamilySSF466891.0E-18134203IPR009057Homeodomain-like
PROSITE profilePS5007117.362142202IPR001356Homeobox domain
SMARTSM003897.0E-17144206IPR001356Homeobox domain
CDDcd000861.09E-15146203No hitNo description
PfamPF000462.5E-16146200IPR001356Homeobox domain
PRINTSPR000313.1E-5173182IPR000047Helix-turn-helix motif
PROSITE patternPS000270177200IPR017970Homeobox, conserved site
PRINTSPR000313.1E-5182198IPR000047Helix-turn-helix motif
SMARTSM003404.2E-27202245IPR003106Leucine zipper, homeobox-associated
PfamPF021832.4E-11202236IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MMVEREDLGL SLSLSFPDHN KKTTNNPMHQ LNLIPSLASS PFDVIHKTSW TDAFPMFPSS  60
DGNSEACRVE TRTFLKGIDV NRLPATAADA DEEAGVSSPN STISSVSGNK RSHEREANNC  120
EEHEMERACS RGNISNSDEE DGETSRKKLR LSKDQSAVLE ESFKEHHTLN PKQKLALAKR  180
LGLRPRQVEV WFQNRRARTK LKQTEVDCEF LKRCCENLTE ENRRLQKEVQ ELRALKLSPQ  240
FYMQMTPPTT LTMCPSCERV GAPPTSSSSG PSSTHMGPAQ TRPMPFNLWA TTPISPQPLN  300
ALHPRS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1144150SRKKLRL
2194202RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0107834e-70AP010783.1 Solanum lycopersicum DNA, chromosome 8, clone: C08HBa0006F21, complete sequence.
GenBankHG9755204e-70HG975520.1 Solanum lycopersicum chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009589459.11e-170PREDICTED: homeobox-leucine zipper protein HAT4-like
SwissprotQ054661e-103HAT4_ARATH; Homeobox-leucine zipper protein HAT4
TrEMBLK4CNI91e-155K4CNI9_SOLLC; Uncharacterized protein
STRINGSolyc08g078300.2.11e-154(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11182485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.11e-100homeobox protein 2